PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_759D8DDBB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 323aa    MW: 35717.5 Da    PI: 8.9128
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_759D8DDBB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-15113159248
                            SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                            + WT+eEd+ll + v++ Gg+ +W++I r ++ gR  k+c++rw ++l
  Traes_4AS_759D8DDBB.1 113 KMWTKEEDDLLREQVRRCGGPhNWDSICRGLP-GRNSKSCRLRWCQHL 159
                            67******************************.***********9986 PP

2Myb_DNA-binding476e-15168210347
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            ++T eEd l+v++ + +G++ W+tIa+ +  gRt++ +k+rw+++
  Traes_4AS_759D8DDBB.1 168 PFTVEEDMLIVKYQAAYGNR-WSTIAEFLS-GRTDNAVKNRWNSV 210
                            89******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.971107163IPR017930Myb domain
SuperFamilySSF466894.4E-27111207IPR009057Homeodomain-like
SMARTSM007172.4E-11111161IPR001005SANT/Myb domain
PfamPF002493.1E-13112159IPR001005SANT/Myb domain
CDDcd001671.15E-12115159No hitNo description
Gene3DG3DSA:1.10.10.602.4E-15115164IPR009057Homeodomain-like
SMARTSM007171.2E-13165213IPR001005SANT/Myb domain
PROSITE profilePS5129417.642168215IPR017930Myb domain
CDDcd001671.21E-11168211No hitNo description
PfamPF002491.8E-12168211IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-18168212IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MCYAAAEAHN SLPRLGQDCL SLQRTRLDSC SDPLRPPSVY IRRHQAAASA PRPPSPFRPL  60
ATATRHQFHP ARSHPSEARR SIQAWGVMMP TSFFQGNDAG ACDGDGSPHG VKKMWTKEED  120
DLLREQVRRC GGPHNWDSIC RGLPGRNSKS CRLRWCQHLD PRVEAVKPFT VEEDMLIVKY  180
QAAYGNRWST IAEFLSGRTD NAVKNRWNSV LRKRQEHAPS QQGQTRPWAP SAARQAAGPG  240
VTPRCLPLFP DSAEEVPEAD TSAAARKCLD LFPLAPGDIR ANAAAVAPPG DMTCGAGDPL  300
TELRLWPAPR VVFDVMPLQA YRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-2411521430127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519190.0JF951919.1 Triticum aestivum clone TaMYB21 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561848.19e-69PREDICTED: transcription factor MYB23-like
TrEMBLW5DY220.0W5DY22_WHEAT; Uncharacterized protein
STRINGMLOC_63274.11e-142(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.13e-34myb domain protein 77
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]